22karianaa 22karianaa

13-12-2018
History

contestada

Britain,France,and Russia became known as the ____ during World War I, and Austria-Hungary,Germany and the Ottoman Empire the central powers

Respuesta :

dj2514500975 dj2514500975

13-12-2018

The triple entente I'm pretty sure. Ask around and make sure.

Answer Link

incognitojalepeno incognitojalepeno

29-03-2021

Answer:

triple entete

Explanation:

Answer Link

Otras preguntas

PLEASE HELP!!!Defining “American”essay should address the following:The IDEAL: what is America supposed to look like? The ACTUAL: what is the America you see?Th

Transforma las siguientes frases afirmativas en negativas, cambiando los elementos subrayados. 1. Mi hermana canta bien. 2. El árbol tiene todavía hojas. 3. El

What landform covers more than half of Europe

what are the beliefs in indonesia?

In the unanimous declaration whos the "he" the author refers to several times

In a softball game, a batter hits the ball at the velocity and angle shown below. What is the maximum range of the ball? Velocity = 32m/s 50° Range A. 95.1 m B.

The larger of two numbers is 6 more than 3 times the smaller. If the twice the larger number is increased by 3 times the smaller, the result is 3. Find the numb

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

The expression 5/2k −2 factored is

which is true about the inside of an animal cell?